Loading...
Statistics
Advertisement

Строй-Инвест - купить квартиру, офис во ...
www.vladstroyinvest.ru/
Купить однокомнатную, двухкомнатную квартиру в новостройках города Владимир. Подроб ...

Vladstroyinvest.ru

Advertisement
Conversion Technology Metas Server
Vladstroyinvest.ru is hosted in Russian Federation . Vladstroyinvest.ru uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Fancybox, Html, Number of used javascripts: 6. First javascripts: Jquery-1.3.2.min.js, Jquery.fancybox-1.3.4.pack.js, Jquery.corner.js, Number of used analytics tools: 1. First analytics tools: LiveInternet counter, Its server type is: Apache/2.2.16 (Debian).

Technologies in use by Vladstroyinvest.ru

Technology

Number of occurences: 4
  • CSS
  • Fancybox
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 6
  • jquery-1.3.2.min.js
  • jquery.fancybox-1.3.4.pack.js
  • jquery.corner.js
  • common.js
  • carousel.js
  • ready.js

Analytics

Number of occurences: 1
  • LiveInternet counter

Server Type

  • Apache/2.2.16 (Debian)

Powered by

  • PHP/5.3.3-7+squeeze16

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Vladstroyinvest.ru

SSL certificate

    • name: /C=XX/ST=XX/L=XX/O=XX/OU=XX/CN=vladstroyinvest.ru/emailAddress=root@vladstroyinvest.ru
    • subject:
      • C: XX
      • ST: XX
      • L: XX
      • O: XX
      • OU: XX
      • CN: vladstroyinvest.ru
      • emailAddress: root@vladstroyinvest.ru
    • hash: 43c7f412
    • issuer:
      • C: XX
      • ST: XX
      • L: XX
      • O: XX
      • OU: XX
      • CN: vladstroyinvest.ru
      • emailAddress: root@vladstroyinvest.ru
    • version: 2
    • serialNumber: 10683814698629115007
    • validFrom: 120515013110Z
    • validTo: 220513013110Z
    • validFrom_time_t: 1337045470
    • validTo_time_t: 1652405470
    • extensions:
      • subjectKeyIdentifier: 5F:15:22:9E:63:27:A0:58:1A:6E:EB:8E:B6:88:9C:28:51:C3:CF:B7
      • authorityKeyIdentifier: keyid:5F:15:22:9E:63:27:A0:58:1A:6E:EB:8E:B6:88:9C:28:51:C3:CF:B7 DirName:/C=XX/ST=XX/L=XX/O=XX/OU=XX/CN=vladstroyinvest.ru/emailAddress=root@vladstroyinvest.ru serial:94:44:88:DC:F5:E2:AC:7F
      • basicConstraints: CA:TRUE

Meta - Vladstroyinvest.ru

Number of occurences: 3
  • Name:
    Content: text/html; charset=utf-8
  • Name: description
    Content: Купить однокомнатную, двухкомнатную квартиру в новостройках города Владимир. Подробная информация об объектах строительства. Поэтажные планы жилых и коммерческих комплексов. Различные варианты ипотечного кредитования и рассрочки платежа. Контакты.
  • Name: keywords
    Content: купить квартиру

Server / Hosting

  • IP: 149.154.68.28
  • Latitude: 55.74
  • Longitude: 37.61
  • Country: Russian Federation

Rname

  • ns2.nameself.com
  • ns1.nameself.com
  • mx.yandex.ru

Target

  • support.regtime.net

HTTP Header Response

HTTP/1.1 200 OK Date: Thu, 21 Jul 2016 04:59:05 GMT Server: Apache/2.2.16 (Debian) X-Powered-By: PHP/5.3.3-7+squeeze16 Set-Cookie: selList=1ke5nqdbmklubcugt7e6sl40g0; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Transfer-Encoding: chunked Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive

DNS

host: vladstroyinvest.ru
  1. class: IN
  2. ttl: 28800
  3. type: A
  4. ip: 149.154.68.28
host: vladstroyinvest.ru
  1. class: IN
  2. ttl: 28800
  3. type: NS
  4. target: ns2.nameself.com
host: vladstroyinvest.ru
  1. class: IN
  2. ttl: 28800
  3. type: NS
  4. target: ns1.nameself.com
host: vladstroyinvest.ru
  1. class: IN
  2. ttl: 28800
  3. type: SOA
  4. mname: ns1.nameself.com
  5. rname: support.regtime.net
  6. serial: 1457610677
  7. refresh: 10800
  8. retry: 900
  9. expire: 604800
  10. minimum-ttl: 10800
host: vladstroyinvest.ru
  1. class: IN
  2. ttl: 28800
  3. type: MX
  4. pri: 10
  5. target: mx.yandex.ru

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ladstroyinvest.ru, www.vyladstroyinvest.ru, www.yladstroyinvest.ru, www.vzladstroyinvest.ru, www.zladstroyinvest.ru, www.vhladstroyinvest.ru, www.hladstroyinvest.ru, www.vnladstroyinvest.ru, www.nladstroyinvest.ru, www.vmladstroyinvest.ru, www.mladstroyinvest.ru, www.vjladstroyinvest.ru, www.jladstroyinvest.ru, www.vkladstroyinvest.ru, www.kladstroyinvest.ru, www.viladstroyinvest.ru, www.iladstroyinvest.ru, www.vadstroyinvest.ru, www.vluadstroyinvest.ru, www.vuadstroyinvest.ru, www.vl8adstroyinvest.ru, www.v8adstroyinvest.ru, www.vl9adstroyinvest.ru, www.v9adstroyinvest.ru, www.vljadstroyinvest.ru, www.vjadstroyinvest.ru, www.vl0adstroyinvest.ru, www.v0adstroyinvest.ru, www.vlmadstroyinvest.ru, www.vmadstroyinvest.ru, www.vlpadstroyinvest.ru, www.vpadstroyinvest.ru, www.vloadstroyinvest.ru, www.voadstroyinvest.ru, www.vldstroyinvest.ru, www.vlaodstroyinvest.ru, www.vlodstroyinvest.ru, www.vlapdstroyinvest.ru, www.vlpdstroyinvest.ru, www.vla9dstroyinvest.ru, www.vl9dstroyinvest.ru, www.vladstroyinvest.ru, www.vldstroyinvest.ru, www.vlaidstroyinvest.ru, www.vlidstroyinvest.ru, www.vlaudstroyinvest.ru, www.vludstroyinvest.ru, www.vlastroyinvest.ru, www.vladtstroyinvest.ru, www.vlatstroyinvest.ru, www.vladgstroyinvest.ru, www.vlagstroyinvest.ru, www.vladbstroyinvest.ru, www.vlabstroyinvest.ru, www.vladxstroyinvest.ru, www.vlaxstroyinvest.ru, www.vladsstroyinvest.ru, www.vlasstroyinvest.ru, www.vladfstroyinvest.ru, www.vlafstroyinvest.ru, www.vladvstroyinvest.ru, www.vlavstroyinvest.ru, www.vladystroyinvest.ru, www.vlaystroyinvest.ru, www.vladzstroyinvest.ru, www.vlazstroyinvest.ru, www.vladastroyinvest.ru, www.vlaastroyinvest.ru, www.vladestroyinvest.ru, www.vlaestroyinvest.ru, www.vladrstroyinvest.ru, www.vlarstroyinvest.ru, www.vladtroyinvest.ru, www.vladsetroyinvest.ru, www.vladetroyinvest.ru, www.vladswtroyinvest.ru, www.vladwtroyinvest.ru, www.vladsdtroyinvest.ru, www.vladdtroyinvest.ru, www.vladsxtroyinvest.ru, www.vladxtroyinvest.ru, www.vladsftroyinvest.ru, www.vladftroyinvest.ru, www.vladsgtroyinvest.ru, www.vladgtroyinvest.ru, www.vladsttroyinvest.ru, www.vladttroyinvest.ru, www.vladsroyinvest.ru, www.vladstqroyinvest.ru, www.vladsqroyinvest.ru, www.vladstaroyinvest.ru, www.vladsaroyinvest.ru, www.vladst royinvest.ru, www.vlads royinvest.ru, www.vladstwroyinvest.ru, www.vladswroyinvest.ru, www.vladsteroyinvest.ru, www.vladseroyinvest.ru, www.vladstzroyinvest.ru, www.vladszroyinvest.ru, www.vladstxroyinvest.ru, www.vladsxroyinvest.ru, www.vladstcroyinvest.ru, www.vladscroyinvest.ru, www.vladstoyinvest.ru, www.vladstrioyinvest.ru, www.vladstioyinvest.ru, www.vladstrooyinvest.ru, www.vladstooyinvest.ru, www.vladstrloyinvest.ru, www.vladstloyinvest.ru, www.vladstrloyinvest.ru, www.vladstloyinvest.ru, www.vladstr.oyinvest.ru, www.vladst.oyinvest.ru, www.vladstryinvest.ru, www.vladstrobyinvest.ru, www.vladstrbyinvest.ru, www.vladstrohyinvest.ru, www.vladstrhyinvest.ru, www.vladstrogyinvest.ru, www.vladstrgyinvest.ru, www.vladstrojyinvest.ru, www.vladstrjyinvest.ru, www.vladstromyinvest.ru, www.vladstrmyinvest.ru, www.vladstro yinvest.ru, www.vladstr yinvest.ru, www.vladstrovyinvest.ru, www.vladstrvyinvest.ru, www.vladstroinvest.ru, www.vladstroyzinvest.ru, www.vladstrozinvest.ru, www.vladstroyainvest.ru, www.vladstroainvest.ru, www.vladstroysinvest.ru, www.vladstrosinvest.ru, www.vladstroydinvest.ru, www.vladstrodinvest.ru, www.vladstroyinvest.ru, www.vladstroinvest.ru, www.vladstroycinvest.ru, www.vladstrocinvest.ru, www.vladstroy invest.ru, www.vladstro invest.ru, www.vladstroynvest.ru, www.vladstroyirnvest.ru, www.vladstroyrnvest.ru, www.vladstroyifnvest.ru, www.vladstroyfnvest.ru, www.vladstroyivnvest.ru, www.vladstroyvnvest.ru, www.vladstroyiknvest.ru, www.vladstroyknvest.ru, www.vladstroyi,nvest.ru, www.vladstroy,nvest.ru, www.vladstroyibnvest.ru, www.vladstroybnvest.ru, www.vladstroyignvest.ru, www.vladstroygnvest.ru, www.vladstroyitnvest.ru, www.vladstroytnvest.ru, www.vladstroyiynvest.ru, www.vladstroyynvest.ru, www.vladstroyiunvest.ru, www.vladstroyunvest.ru, www.vladstroyijnvest.ru, www.vladstroyjnvest.ru, www.vladstroyimnvest.ru, www.vladstroymnvest.ru, www.vladstroyinnvest.ru, www.vladstroynnvest.ru,

Other websites we recently analyzed

  1. OPF S.A.
    elementy aktywne i bierne linii światłowodowych, złącza światłowodowe, wzmacniacze optyczne, dzielniki mocy optycznej, tłumik, systemy transmisyjne; budowa linii telekomunikacyjnych dalekosiężnych i miejscowych, sieci komputerowych, światłowodowych
    Poland - 212.182.89.166
    Server software: Apache
    Technology: CSS, Html, Javascript, Swf Object, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 6
  2. estousolteiro.com
    San Diego (United States) - 216.104.165.64
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Html, Html5, Javascript
    Number of meta tags: 5
  3. به وب سایت ابراهیم وحید زاده خوش آمدید
    به وب سایت ابراهیم وحید زاده خوش آمدید
    Phoenix (United States) - 64.62.132.7
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 3
  4. cherrybeard.com is almost here!
    The owner of this domain has not yet uploaded their website.
    Brea (United States) - 67.205.11.203
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  5. Berufsverband Tiergestützte Therapie, Pädagogik u. Fördermaßnahmen
    Homepage des Berufverbandes tiergestuetzte Paedagogik, Therapie und Foerdermaßnahmen. Informationen zum Thema tiergestuetzte Arbeit aus Forschung und Praxis.
    Germany - 217.160.233.198
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 4
  6. gtib.cn.com
    China - 103.232.215.150
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. medicalmalpracticelawyerpennsylvania.com
    Houston (United States) - 108.167.131.22
    Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  8. EQ Logik - Sönke Wulff
    Germany - 213.203.239.230
    Server software: Apache/2.0.55 (Debian) FrontPage/5.0.2.2635 PHP/4.4.2-1+b1 mod_ssl/2.0.55 OpenSSL/0.9.8c
    Technology: Html
    Number of meta tags: 1
  9. Fasching-Karneval-Shop
    Spezialist für Karneval, Fasching, Halloween Oktoberfest Weihnachten, Nikolaus, Ostern, 60er Jahre, 70er Jahre, 80er Jahre, Mottopartys, Themenpartys, Karnevalskostüme, Faschingskostüme, Perücken, Brillen, Bärte, Jungesellenabschied und Zubehör
    Germany - 62.104.45.105
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery UI
    Number of Javascript: 11
    Number of meta tags: 5
  10. Hoststar - Webspace und Hosting mit vielen Vorteilen - Top Webhosting zum sensationellen Preis
    Wir bieten Ihnen Webhosting, Reseller-Hosting, Domains und vServer für Ihren Internetauftritt bereits ab CHF 5.90 pro Monat.
    Germany - 5.9.101.76
    Server software: Apache
    Technology: CSS, Html, Html5, SVG
    Number of meta tags: 3

Check Other Websites